SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003089330.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003089330.1.11157
Domain Number - Region: 70-94
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0023
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003089330.1.11157
Sequence length 211
Comment hypothetical protein CRE_27957 [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MPFVLKFGSVSSATSTSSTDRSSRSEDVGGDSGKKPSLAALAQSAFPSRYDPNAFVDISG
ATIAAPTITGACKRCGYPGHLYFQCRNHIEVRPNQSTKAYEVSSTSSESSDEEDTPLIAL
EKERKRAKKLKKKERREKKKVKKMEKKEKKERKRSRKDSDDSDSDSEEERKKKKRSKKSK
KEKKKRRHSDSDDSDSDDGDRHRDSKRRRRD
Download sequence
Identical sequences E3NQJ1
CRE27957 31234.CRE27957 XP_003089330.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]