SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003091650.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003091650.1.11157
Domain Number 1 Region: 147-179
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000314
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Domain Number 2 Region: 221-327
Classification Level Classification E-value
Superfamily Acid proteases 0.0000375
Family Retroviral protease (retropepsin) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003091650.1.11157
Sequence length 502
Comment hypothetical protein CRE_18272 [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MKTTKLLDEMKEHSIFDVSLQILGSQLRKCPEMEQYELCREEATRFDEEWRSGKAKQNEK
KMNRQQSNQNFSNQQSNYSNQNTSYSRNKQTVGNDETSQNWRERSQGKFVPTNNAGGNNV
VNKSVGFSECSECRLTGCHDPKCSRAPGSSTPRKSNPVVCFRCNEQGHIAPNCPQKSAQQ
LNSQGDMAKVQTLDKKECLEMPEAEKSKQNKNSRTPVRIEQGRIGSAEVNFVIDSGACIS
VISENTWKEVVEKNGGKEWEKEAILKNPEKIDVYAANNTPMNLLYQVKVETSLHSRTRDL
KFYVTDIDRDTVILGIDQFELLGIQMSFQKKPRDIRMVRQVKIPPGSEKIVEVSVEGTIR
KDKSLCLITPMVSCLAPAIYQIRKSGKARVQMSNLGKKSIFLKKGELVASGEVEGFDVIE
ENEENLKLLEEFFERSKLLEQDMETINLIETNVNSGERWDILCEQLKKTCAKSEEEEDVW
KVIKDYQHIFATDDTELGRTNV
Download sequence
Identical sequences E3NIW9
31234.CRE18272 XP_003091650.1.11157 CRE18272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]