SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003092844.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003092844.1.11157
Domain Number 1 Region: 300-399
Classification Level Classification E-value
Superfamily Acid proteases 0.0000253
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 
Weak hits

Sequence:  XP_003092844.1.11157
Domain Number - Region: 240-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000314
Family Retrovirus zinc finger-like domains 0.0058
Further Details:      
 
Domain Number - Region: 54-165
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0767
Family IMD domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003092844.1.11157
Sequence length 685
Comment hypothetical protein CRE_18249 [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MSFSTERTKKRSSSVTSFEKSWAVQMNEVRLKERRKLVRGFTDFLESSGRMESDMYEALK
AACKGNERQSEVLVEPVKKYCQELRERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVPGGIVENANKAQDELALLQDAWNEERETLFRELNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQESEPKKAGQARDTKEVPVPSRLEVVRKWSPRDSDDEFSMHGRR
GDRKTVGERRDSGAKIKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMVEML
GQRRRVVIDSGAVVSVISTTAYEKLKEGCRDWEKEVEVFGKPTFTVLNASNSKMRVREQI
KIPMVVRGRKVRVVFQLVDNWVERILIGTNAFESIGVELKWKDPYGLVNAEENSAEVQFI
GGEKKLERPGEKLRKVPTEVSGIQCKSVAVRGERGRRASTGDVGEFKSEGEEKERKKVKI
RASVAVIGPRLEARGPGVLEYRNKTITGWTQKFDWGEVKKAVVLVEYTDKEDENSKRVEF
VKSVAKEVEKVWMMPRSLQCELGDVDKVAKQWKEWLKTSANVEVVDPLMPVGNHKTPLIL
EKWHRKSLDGLQKYLHNALPSHSVRCQWEKNTDRRPLSGLKKDLGKGCPIAERRGKWLRR
SSTFSKPHGITEVKGNEYSRGNRKT
Download sequence
Identical sequences E3NFH8
CRE18249 XP_003092844.1.11157 31234.CRE18249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]