SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003095641.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003095641.1.11157
Domain Number 1 Region: 516-616
Classification Level Classification E-value
Superfamily Acid proteases 0.00000317
Family Retroviral protease (retropepsin) 0.026
Further Details:      
 
Domain Number 2 Region: 468-493
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000454
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003095641.1.11157
Sequence length 655
Comment hypothetical protein CRE_13664 [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MSHKTSSKQSTSKVDDNRMIVVETQMSVKERRKKVKKFTKLIASSVKVEDEIRLQLGELT
AKCSEQEADAILEPMRIFHRELLEKFEEIGGDEWPRSVIRVMREFKLESVEELREACAKA
AESEEAEWSVGKVNLELQKVQYEKNLLTECWNEEKEMLGEQIRKIQREKEVAEAQVSRLE
KALKQLRKTVERQERKPNGLWDETQGNRSWCERVENWDIERNYEGNRKKGGEDAFSRKTL
SRSGSSEVNEMVQCMNRMLKSSALPEPKTFDGTGEFKEFKRAFLLKYNHVTESDDELVAI
LEEKFLKGAAKSLFKTLPKRYERSIQSLFEEFEHKLRKRQGDSKIEALNEFEGLEKRSDQ
KMWEYLVEVEKWSRKAFPEVKQETLSQMRTTKLMKAARADETLHKMLIMKRFELSLEEQY
EHLKDIVLQQENEQRRGNSQKSGNSEGWKERPKAENDGEKDVAEKESEENRYWREQKCFS
CGGVGHLARQCSPKPVQSVEVRGKGEGVGIVAVETVMMLGQERKMVIDSGAAVSVMSTGA
WNGLKKGCRNWVEVVKRLGKPSFEVIDTSKKKMRIIQQFEVPIQVRDRKAEVVFQLVEND
AEIMLLGTNAFESIGVSVEWKQERMDVEFHHIGASAARDGHSCFLRMCMIHKVMY
Download sequence
Identical sequences E3N7J5
CRE13664 XP_003095641.1.11157 31234.CRE13664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]