SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003096575.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003096575.1.11157
Domain Number 1 Region: 600-694
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000217
Family Retroviral protease (retropepsin) 0.032
Further Details:      
 
Domain Number 2 Region: 484-515
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000161
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003096575.1.11157
Sequence length 885
Comment hypothetical protein CRE_02577 [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MVARPTRFIGVEVYSLVHRNFILPAPAIRLVPDNRRTPMVIRHQVSFGGGTTSVRRRSFA
EVVIGASRPQFRAFSGDAKRTGDPMQFNATTSVSSEEMPIREEASAVIVPIREESIALVS
SIREGSSVLVSTIREESDVLVREGSDNWHSPICEESCEMDPWHRDESRGLDTPYSINTEV
RSSVSSGIGKQVSPVVTATICEGSDTDAVASDNVKGCYENILTELCSNSETHPRVMTISL
VDDAVIVSKQEAESDHVTSSGNEDRKQCSHMHSTPHVMMISLEDDVRLSRYSGSDNEDLA
EFVRSFEDKFAITGKDDNVKGKFFLAYLKEDARDTVQEVLDNNKNATFDQLVESLKKRFM
NPALNDRFKQQLRSRTKRAGETVEEFYRGVTRLVKRIHSSTSSAVAKDAILDQFLYGLDD
NIMKMHVKLSKPKTPQDALETALSVEGVMTMPKHTDVLSIPRVLAATAEKVTSRDNSLRE
SDDVRKSSVGSQQCYYCQDEGHYAWQCPEKARRHHQPGSSRAQIGCIHVNARVDELQQAL
RANEVLQQRRDRLTDQEHEGNFRSECYTIQCRNENAQKGPSCNAEYKDFGAPASIISASI
PIEANDYACLALVDTGAAITLTSGVMCSRLGLPEPEAPLKKTVIGIGNASVKIAGSRVIT
FTIGSYRINHRVHITAEPLGDYDFLLGIDLLSRLPNIGFDFREAKMSIGKDVLPLGERSK
CQECQRRSLENRTLKDQKSSWSEEAHEGTYTDFVIVDSWAEEMESSQVQEAVESKPSKLT
KRPKLQSTPKRKGTCHYWGRTSAPVTLSWPRRSKLSGNKLKSCSCRIESSFLNVLPHANT
HTRAAPQQSTEVEKTEVEVEKTEEEQNVTSSSHCDQEQKDRQSSM
Download sequence
Identical sequences E3N4T9
XP_003096575.1.11157 31234.CRE02577 CRE02577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]