SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003104255.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003104255.1.11157
Domain Number 1 Region: 87-180
Classification Level Classification E-value
Superfamily PDZ domain-like 1.05e-27
Family PDZ domain 0.0072
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily L27 domain 1.65e-22
Family L27 domain 0.0000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003104255.1.11157
Sequence length 210
Comment CRE-LIN-7 protein [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MDTPDGPNLERDVQRILELMEHVQKTGEVNNPKLASLQQVLQSEFFGAVREVYETVYDSI
DADTTPTTKAAATAKATVAAFAAAEGHAHPRIIELPKTDQGLGFNVMGGKEQNSPIYISR
IIPGGVADRQGGLKRGDQLIAVNGVNVESECHEKAVDLLKSAVGSVKLVVRYMPKLLDEM
ERRFERQRLRSTQQSPTLPTPSGPSTAPRR
Download sequence
Identical sequences E3MHZ7
XP_003104255.1.11157 31234.CRE24909 CRE24909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]