SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003114549.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003114549.1.11157
Domain Number 1 Region: 113-145,220-305
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-20
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003114549.1.11157
Sequence length 362
Comment hypothetical protein CRE_27384 [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MKSNGAAKKDEKVAVPGRSKSADSKWKERMNRGIGNMSKSLPSFNKNATNSDKLSDTKVV
VIEDESKKKKKKKKKDKNLDVEELPQQEDPEVLAAKEKEKQAKIMIANQDARNKTMWRHM
AWLVILFAFSLFGGVIFSAIEGGYETTQLIKKFEHEKDVYERRKIYQEQLFQRLREIEQD
NTNPRGRNSSREHFKLEQSRHALEWYEQKMGVTIYEPQMRETKWNLWGGVYYSASLYTTI
GYGNFHPLTKSGRIISMMYACVGIPLVFTILLDWGFLYFTWIEYGWNRFNENFCQKSLQR
DMQRRIRRERIRRVGSELSLSSTAPLLHRTTTQLSNPVQHVRLNSEIFQVELSTFRLNQI
IR
Download sequence
Identical sequences E3LQ45
XP_003114549.1.11157 CRE27384 31234.CRE27384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]