SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003126145.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003126145.1.46622
Domain Number 1 Region: 35-147
Classification Level Classification E-value
Superfamily FKBP-like 3.54e-37
Family FKBP immunophilin/proline isomerase 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003126145.1.46622
Sequence length 201
Comment peptidyl-prolyl cis-trans isomerase FKBP11 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MTLRPSFLPLRLLLLLLLSGAMCRAEAGFETESPVRTLQVETLVEPPEPCAEPAAFGDTL
HIHYSGSLVDGRIFDTSLSRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRVIIPSHLAYG
KRGFPPSIPADAELHFDVELIALIRANYWQKLVKGILPLVGMAMVPALLGLIGYHLYKKA
SRPKVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences 9823.ENSSSCP00000000187 ENSSSCP00000000187 XP_003126145.1.46622 ENSSSCP00000000187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]