SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003196027.1.73883 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003196027.1.73883
Domain Number 1 Region: 346-540
Classification Level Classification E-value
Superfamily MIR domain 1.96e-59
Family MIR domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003196027.1.73883
Sequence length 919
Comment Dolichyl-phosphate-mannose--protein mannosyltransferase 2, putative [Cryptococcus gattii WM276]; AA=GCF_000185945.1; RF=representative genome; TAX=367775; STAX=37769; NAME=Cryptococcus gattii WM276; strain=WM276; AL=Chromosome; RT=Major
Sequence
MSQPLTRRAPLQPHPSQPSTFASKVTVESEADARLKDHHAGPYTIQKTAFGGKRGSAAVG
RIGKREWTMIAGMVVVALYVRLYRLGRPSSVVFDEVHFGGFAMKYIRRKFFMDVHPPLAK
LLVTLSAWVGGFDGKFDFKDIGKDYLEPGVPYITMRFFPAALGIALIPLAFLTLLALRLS
HTSALLGALFVTFDNALITQSRLILLDSFLVFFTGLTTFFWVRFSNEDSEGRAFTKPWWI
NLLCTGLSLGAVVSCKWVGLFTIAMIGVGTLRQLWLLLGNLKVTPRQYIRHFAARTLCLI
VVPLAFYMLMFKIHFWILNESGDGDGFMSSEFQHTLQGHGMADTFADVGFGSKVSIRHVN
TQGGYLHSHPHPYPGGSKQQQITLYPHRDDNNVWRIVNASAPDGPSSYPWDELPFEYVLT
GTKIRLEHVTTEKRLHSHDIRPPVSEVDFQNEVSGYGFPGFAGDANDDFIVEITKHTRGR
NDKQAKHRLKTLRSEFRLRHALSGCYLFSHKVKLPDWGYEQQEVTCNKNPTWENSLWYIE
TNQHAQLSMDAERVNYEKPSFFEKFFELNAVMWRTNAGLTERHAYDSRPQHWPWLRRGIN
FWVKDHRQVYLIGNPVVWWSSTAAIVAYVIVRGFLVLRAQRGYRDLNQPKLAFYDDICAF
CVIGWALHYFPFYLMQRQLFLHHYLPALYFAILLFCTVFDYTTSALRPRIRTNIAIAILI
LALWSWNHWSSLAYAGEWTKSACENGKWLRTWDFSCNDFYESTSMYNSHAAMSSEKIAAT
DLGPDSATTTFIEDVPEPIQNVFQQDPPPEEKTIAPVGPAPVVQMEESSAVFIPEGEEAP
VVEDLRAPVGNDAGDPAVTDGEDDGGWHGGAEEGQHGQRKDEVKTKEGEAPVGARVDIPD
MGLDEERKLLVDQIMSEQE
Download sequence
Identical sequences A0A0D0Y5C0 E6RBP4
XP_003196027.1.73883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]