SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003206959.1.16129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003206959.1.16129
Domain Number 1 Region: 45-192
Classification Level Classification E-value
Superfamily EF-hand 2.38e-35
Family Calmodulin-like 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003206959.1.16129
Sequence length 194
Comment PREDICTED: myosin light chain 3 [Meleagris gallopavo]; AA=GCF_000146605.2; RF=representative genome; TAX=9103; STAX=9103; NAME=Meleagris gallopavo; breed=Aviagen turkey brand Nicholas breeding stock; AL=Chromosome; RT=Major
Sequence
MPPKKPEPKKAPEPKKEEPKPAPKPAEPEPKKEVEFNPASIKVEFTPDQIEEFKEAFSLF
DRTPKSEMKITYAQCGDVLRALGQNPTQAEVMKVLGRPKQEDMNSKMIDFETFLPMLQHI
AKTKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEEEVDKLMAGQEDANG
CINYEAFVKHIMAN
Download sequence
Identical sequences G1MUW1
ENSMGAP00000002363 XP_003206959.1.16129 XP_015708474.1.68032 ENSMGAP00000002363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]