SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003215177.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003215177.1.98722
Domain Number 1 Region: 5-217
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.88e-67
Family D-ribulose-5-phosphate 3-epimerase 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003215177.1.98722
Sequence length 228
Comment PREDICTED: ribulose-phosphate 3-epimerase [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MASGCRIGPSILNSDLAALGAECTRMLDCGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQQPFFDMHMMVAKPEQWVKSMAVAGANQYTFHIEATDNAGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTIHKCAEAGANMIVSGSAIMKSDDPRSVINLLRNVCCEAAQKRSLDR
Download sequence
Identical sequences G1KKI6
ENSACAP00000010580 XP_003215177.1.98722 ENSACAP00000010580 28377.ENSACAP00000010580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]