SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003221902.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003221902.1.98722
Domain Number 1 Region: 244-333
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-20
Family Canonical RBD 0.00019
Further Details:      
 
Domain Number 2 Region: 393-480
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-19
Family Canonical RBD 0.0001
Further Details:      
 
Domain Number 3 Region: 142-238
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.64e-18
Family Canonical RBD 0.0011
Further Details:      
 
Weak hits

Sequence:  XP_003221902.1.98722
Domain Number - Region: 30-39
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0107
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003221902.1.98722
Sequence length 485
Comment PREDICTED: G-rich sequence factor 1 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MPPPPRPGALAPPPRLRSRPQVATWSGLLPPPPRPPPPPMAAGTRWVLGALLRQTGAASA
SLGLSSSRRLLRFLGAAAAAAAATQSRGLSRSAGPVPGLSALPGRPLLAPALALHARTGF
AQDHSTPFQEEYPPLSEYEPHPAKSGEEEEDVYLIRAQGLPYSCTEEDVLNFFAGSKIRN
GVNGIHFLLNRDGKRRGDALVELESEQDVHNALEKHRRYLGQRYVEVFEIHNEDVDAIMK
SLQSSSTSVTNDGVVRLRGLPYSCTEVDISDFFSGLSIIDITFVMDQRGRRKTGEAFVQF
ATPEMANQALLKHKEEIGNRYIEIFPSQRSEIRTHNGFFRGKKMMGFPTTKQDSDSVFNE
GDFNEALRPVAAYENAKEHELFKQAFERPRDLQESRSFPSLHFVHLRGLPFQATAQDIIN
FFAPLKPVRITMEYNSSGKATGEADVHFETHEDAIAAMAKNRSHVQHRYIELFLNSSPSR
KNGCQ
Download sequence
Identical sequences G1KN05
XP_003221902.1.98722 ENSACAP00000012709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]