SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003237722.1.23396 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003237722.1.23396
Domain Number 1 Region: 341-540
Classification Level Classification E-value
Superfamily MIR domain 7.06e-60
Family MIR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003237722.1.23396
Sequence length 939
Comment mannosyltransferase [Trichophyton rubrum CBS 118892]; AA=GCF_000151425.1; RF=representative genome; TAX=559305; STAX=5551; NAME=Trichophyton rubrum CBS 118892; strain=CBS 118892; AL=Scaffold; RT=Major
Sequence
MASKASNAGLEAKTPSKSRSKSRSKSRSPGPKGASKQSKTHDYRSDGVKDYDVLNLPVSD
YKIMLVITAIATVVRLFRIYQPSSVVFDEVHFGGFATKYIKGKFFMDVHPPLAKLLITLA
GHLAGFKGDFDFKEIGKDYLEPGVPYVAMRMLPAIMGIMTVPTMFLTLKATGCRTSTASF
GALLVTFENALVTQSRFILLDSPLIIFTALTVLSFVSFSNQHEQGPPKAFGCSWWFWLVA
SGLFLGATASVKWVGLFTIAWVGSLTLIQLWVLLGDSKTVTPHLWFKHFFARALCLIVIP
VGLYMAMFGIHFLCLRNPGEGDGFMSSEFQATLNSKGMGDTPVDVVFGSRVSIRHHNTQG
GYLHSHSHMYPGGSKQQQITLYPHKDDNNIFILENQTQPLGPYGQVPGPRAWDNITTEHI
MDGDTIRLYHMATDRRLHSHDVRPPVTEADWQQEVSAYGYEGFEGDANDLFRVEIVPSMS
DGAEAKKRLRTIQTKFKLVHVMTGCVLFSHKVKLPEWGFDQQEVTCAKGGSLPNSIWYIE
QNSQPALPDDVEKVNYKIPNFFAKFWELHKVMWRTNAGLVDSHAWDSRPPSWPILSRGIN
FWGRHHRHVYLIGNPVIWWTSTAAVVIWVVFKGIAVLRWQRGFKDYNHVHFKRFDYEIGQ
TLLGWALHYFPFYLMARQLFLHHYLPALYFAILAFCQIYDFVANRFNKPSIFGKLFTVAF
LSLSVAAFCILSPLAYGNPWTKGMCQKTKLISTWDFDCNLFHNDLSQYAIPEVINTSEAA
PTSIAAPPVQQEQQQGGQQQEQQPEQQANQVPVQPESPQQPPAVDPDLRKVREVEYRDSE
GNILSEEQVKALQEQGEISFETRYETRTRLIDNEGRELPKEAIIAPEHPDVQGANPETVA
KDELKAPANKPAEVKGENESPKKKENKPKPASEAKAATN
Download sequence
Identical sequences A0A022VTA7 A0A022XJ47 A0A178EZM5
TERG_02437T0 XP_003237722.1.23396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]