SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003253832.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003253832.1.23891
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-22
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003253832.1.23891
Sequence length 300
Comment PREDICTED: pleckstrin homology domain-containing family A member 3 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTR
MELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSEL
RLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAK
FKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRR
RTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS
Download sequence
Identical sequences G1R2P1 G3RTW6 H2QJ23 Q9HB20
NP_061964.3.87134 NP_061964.3.92137 XP_003253832.1.23891 XP_003815558.1.60992 XP_004032918.1.27298 XP_515943.2.37143 ENSPTRP00000021689 ENSNLEP00000007463 ENSP00000234453 ENSP00000234453 ENSP00000234453 ENSGGOP00000012663 ENSNLEP00000007463 ENSPTRP00000021689 gi|54792084|ref|NP_061964.3| ENSGGOP00000019243 9598.ENSPTRP00000021689 9606.ENSP00000234453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]