SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003258850.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003258850.1.23891
Domain Number 1 Region: 2-420
Classification Level Classification E-value
Superfamily ALDH-like 5.5e-155
Family ALDH-like 0.00000000000859
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003258850.1.23891
Sequence length 424
Comment PREDICTED: 4-trimethylaminobutyraldehyde dehydrogenase [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MERCRILLEAARIIRERKDEIATMECINNGKSIFEARLDIDISWQCLEYYAGLAASMAGE
HIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIASWKSAPALACGNAMVFKPSPFTPVSAL
LLAEIYTEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKP
VTLELGGKSPLIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVK
QTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDMYVPEDPKLKDG
YYMRPCILTNCRDDMTCVKEEIFGPVMSILSFDTEAEVLERANDTTFGLAAGVFTRDIQR
AHRVVAELQAGTCFINNYNISPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDV
ESAF
Download sequence
Identical sequences XP_003258850.1.23891 ENSNLEP00000024168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]