SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003261903.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003261903.1.23891
Domain Number 1 Region: 1-347
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.44e-73
Family ADP-ribosylglycohydrolase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003261903.1.23891
Sequence length 357
Comment PREDICTED: ADP-ribosylarginine hydrolase [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMH
LATAEALVEAGKAPKLTRLYYLLAKHYQDCMEDMDGRAPGNASVHNAMQLKPGKPNGWRI
PFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTA
YAVNARPPLQWGKGLMELLPEAKKYVVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGE
SAPTFPEPFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHG
GDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
Download sequence
Identical sequences G1QYJ4
ENSNLEP00000006015 XP_003261903.1.23891 ENSNLEP00000006015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]