SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003262030.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003262030.1.23891
Domain Number 1 Region: 253-344
Classification Level Classification E-value
Superfamily TAFH domain-like 1.31e-33
Family TAFH domain-like 0.0000293
Further Details:      
 
Domain Number 2 Region: 654-702
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000419
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003262030.1.23891
Sequence length 862
Comment PREDICTED: transcription initiation factor TFIID subunit 4B isoform X2 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MPAGLTEPAGAAPPATVSASGTVTMAPAGALPVRVESTPVALGAVTKAPVSVCVEPTASQ
PLRSPVGTLVTKVAPVSAPPKLSSGPRLPAPQIVAVKAPNTTTIQFPANLQLPPGTVLIK
SNSGQLMLVSPQQTVTRAETTSNITSRPAVPANPQTVKICTVPNSSAQLIKKVAVTPVKK
LAQIGTTVVTTVPKPSSVQSVAVPTSVVTVTPGKPLNTVTTLKPSSLGASSTPSNEPNLN
AENSAAVQINLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEA
EEFTRKLYVELKSSPQPHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDIVIATCTTT
VTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPAAA
TGGTTAGTVLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVTLSLPAVTFGETSGAAVC
LPSVKPVVTSAGTTSDKPVIGTPIQIKLAQPGPVLSQPAGIPQAVQVKQLVVQQPSGGNE
KQVTTISHSSALTIQKCGQKTMSVNTVIPTSQFPPASILKQITLPGNKILSLQASPTQKN
KIKENGTSCFRDEDDINDVTSMAGVNLNEENACILATNSELVGTLIQSCKDEPFLFIGAL
QKRILDIGKKHDITELNSDAVNLISQATQERLRGLLEKLTTIAQHRMTTYKASENYILCS
DTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQ
IQHRDANLTALAAIGPRKKRPLESGIEGLKDNLLASGTSSLTATKQLHRPRITRICLRDL
IFCMEQEREMKYSRALYLALLK
Download sequence
Identical sequences ENSNLEP00000007967 XP_003262030.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]