SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003264064.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003264064.1.23891
Domain Number 1 Region: 75-290
Classification Level Classification E-value
Superfamily FKBP-like 1.06e-30
Family FKBP immunophilin/proline isomerase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003264064.1.23891
Sequence length 1220
Comment PREDICTED: FK506-binding protein 15 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MFGAGDEDDTDFLSPSGGARLASLFGLDQAAAGHGNEFFQYTAPKQPKKGQGTAATGNQA
TPKTAPATMSTPTILVATAVHAYRYTNGQYVKQGKFGAAVLGNHTAREYRILLYISQQQP
VTVARIHVNFELTVRPNNYSTFYDDQRQNWSIMFESEKAAVEFNKQVCIAKCNSTSSLDA
VLSQDLIVADGPAVEVGDSLEVAYTGWLFQNHVLGQVFDSTANKDKLLRLKLGSGKVIKG
WEDGMLGMKKGGKRLLIVPPACAVGSEGVIGWTQATDSILVFEVEVRRVKFARDSGSDGH
SVSSRDSAAPSPIPGADNLSADPVLSPPTSIPFKSGEPALRTKSNSLSEQLAINTSPDAV
KAKLISRMAKMGQPMLPILPPQLDSNDSEIEDVNALRGGGQPVVTPSIQPSLQPAHPALP
QMTSQAPQPSVSGLQAPSAALMQVSSLDSHSTLSGNAQSFQPYAGMQAYAYPQASAVTSQ
LQPVRPLYPAPLSQPPHFQGSGDMASFLMTEARQHNTEIRMAVSKVADKMDHLMTKVEEL
QKHSAGNSMLVPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIE
RNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMT
AHQKKETELQMQLTESLKETDLLRGQLTKVQAKLSELQETSEQSQSKFKSEKQSRKQLEL
KVTSLEEELTDLRVEKESLEKNLSERKKKSAQERSQAEEEIDEIRKSYQEELDKLRQLLK
KTRVSTDQAAAEQLSLVQAELQTQWEAKCEHLLASAKDEHLQQYQEVCAQRDAYQQKLVQ
LQEKCLALQAQITALTKQNEQHVKELEKNKSQMSGVEAAASDPSEKVKKIMNQVFQSLRR
EFELEESYNGRTILGTIMNTIKMVTLQLLNQQEQEKEESSSEEEEEKAEEQPRRPSQEQP
ASASSGQPEAPLNRERPESPMVPSEQVVEEAVLLPPQALTTSQDGVHRRKGDSEAETLSE
IKDGSLPPELSCIPSHRVLGPPTSIPPEPPGPVSVDSECEESLAASPVAAKPDNPPGKVC
VREVAPDGPLQESSTRLSLTSDPEKGDPLALGPESPGEPQPPQLKKDDVTSSTGPHEELS
STETGSTVAGAALRPSHHSQHSSLSGDEEDELFKGATLKALRPKAQPEEEDEDEVSMKGR
PPPTPLFGDDDDDDDIDWLG
Download sequence
Identical sequences ENSNLEP00000020175 ENSNLEP00000023563 XP_003264064.1.23891 ENSNLEP00000020175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]