SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003270311.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003270311.1.23891
Domain Number 1 Region: 56-356
Classification Level Classification E-value
Superfamily BEACH domain 1.22e-129
Family BEACH domain 0.0000000000118
Further Details:      
 
Domain Number 2 Region: 473-726
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.06e-31
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000861
Family PreBEACH PH-like domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003270311.1.23891
Sequence length 739
Comment PREDICTED: neurobeachin isoform X3 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQ
ARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNY
ESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLS
WLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVN
SNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQR
GPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAM
HLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVN
RWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTA
DNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDAT
LLLWYWSGRHHIIGDNPNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVH
TITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSINGKLLAQMEINDSTRA
ILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGS
IVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences A0A2J8MLK4 A0A2J8UTL5 A0A2K6MX50
gi|323510703|ref|NP_001191126.1| NP_001191126.1.87134 NP_001191126.1.92137 XP_003270310.1.23891 XP_003270311.1.23891 XP_011798424.1.43180 XP_020146020.1.48125 ENSP00000440233 ENSP00000440233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]