SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003279928.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003279928.1.23891
Domain Number 1 Region: 103-201
Classification Level Classification E-value
Superfamily POZ domain 3.49e-24
Family BTB/POZ domain 0.003
Further Details:      
 
Domain Number 2 Region: 270-374
Classification Level Classification E-value
Superfamily POZ domain 4.71e-23
Family BTB/POZ domain 0.02
Further Details:      
 
Domain Number 3 Region: 5-78
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000466
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003279928.1.23891
Sequence length 478
Comment PREDICTED: ankyrin repeat and BTB/POZ domain-containing protein 1 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGA
RCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFV
VHGKPFRVHRCVLGARSAYFANMLDTKWKGKSVVVLRHPLINPVAFGALLQYLYTGRLDI
GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLRED
MALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVAGCSFLCHKAFFCGRSDYFRAL
LDDHFRESEEPVTSGGPPAVTLHGISPDVFTHVLYYVYSDHTELSPEAAYDVLSVADMYL
LPGLKRLCGRSLAQVLDEDTVVGVWRVAKLFRLARLEDQCTEYMAKVIEKLVEREDFVEA
VKEEAAAVAARQETDSIPLVDDIRFHVASTVQTYSAIEEAQQRLQALEDLLVSIGLDC
Download sequence
Identical sequences A0A2I3FSG2
XP_003279928.1.23891 ENSNLEP00000017236 ENSNLEP00000017236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]