SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003309885.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003309885.1.37143
Domain Number 1 Region: 104-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-54
Family DBL homology domain (DH-domain) 0.0000597
Further Details:      
 
Domain Number 2 Region: 324-447
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003309885.1.37143
Sequence length 526
Comment PREDICTED: rho guanine nucleotide exchange factor 3 isoform X6 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPL
KRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKE
IKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEEL
LSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQR
CLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAE
INTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLFQEVLVI
TRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN
GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGE
TKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV
Download sequence
Identical sequences G3SD09 H2PAG2 H2QMT7 Q9NR81
ENSGGOP00000025987 ENSPPYP00000015414 ENSP00000296315 ENSP00000296315 ENSPPYP00000015414 HR2945 gi|9506401|ref|NP_062455.1| NP_062455.1.87134 NP_062455.1.92137 XP_003309885.1.37143 XP_003776266.1.23681 XP_003818761.1.60992 XP_004034389.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]