SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003340069.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003340069.1.35504
Domain Number 1 Region: 376-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000055
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 633-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000484
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 3 Region: 922-969
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000572
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  XP_003340069.1.35504
Domain Number - Region: 695-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000672
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 162-172
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0128
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 30-58
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0886
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003340069.1.35504
Sequence length 1017
Comment PREDICTED: sal-like protein 2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MSRRKQRKPQQLISDCDGSTTSENGDTGDEDQPQVCAKCCAQFTDPTEFLTHQNTCCTDP
PVMVILGSQENSSSNSSSSSEARAEGQDSPQIMDTEHGNPPDPGPSVPTDASWGPDRARE
DSSDHFLITTAGATSASGGGGLILASPKLGATPLASESTPAPPPPPPPPPPPGAGSGHLN
IPLILEELRVLQQRQIHQMQMTEQICRQVLLLGSLGQSVGTTASPSELPGTGAATSSKTL
LPLFSPIKPGQASKTLTPASSSSSSSSSGAEVPKPTFFHLYHPLGAQHPFSSGSVGRSHK
PTPTPTPSPALPGTTDQLISSPHLAFPGTTGLLAAQCLGAARGLEAASSPGLLKPKNGSG
ELGYGEVMGPLEKPGGRHKCRFCAKVFGSDSALQIHLRSHTGERPYKCNVCGNRFTTRGN
LKVHFHRHREKYPHVQMNPHPVPEHLDYVITGSGLPYGMSVPPEKAEEETTSGGAERKPL
SASATALTATESLTLLSTTAGTATAPGLPTFNKFVLMKAVEPKNKADENTPPGSEGSAVS
GGTETGTTTRMQLSKLVTSLPSWALLTNHFKTSGGFPFPYVLEPLGASPSETSKLQQLVE
KIDRQGAAGAVSTASGASTTSAPAVSSSASSGPNQCVICLRVLSCPRALRLHYGQHGGER
PFKCKVCGRAFSTRGNLRAHFVGHKASPAARAQNSCPICQKKFTNAVTLQQHVRMHLGGQ
IPNGGTILPEGGVAMKESGAEQSAPLAAGVFPQQQQQQQQQPQQQASPEEELSEEEEEEE
EEDEEDITDEDSLAGRGSESGGEKAISMRGDSEEASGPEDETVATIAASGKEMDSGEKSA
QQPSLPLPGNLEEPQSMEHGKNELIGGIEGGGQPEGNSSPTSVLSPEGEVVSAIIAEGPG
IQEARRKEHGESMSSSSNSKRSCGVCGQSCPSQAALEEHHKAHSKEGSLFTCSICKQGFP
ERATLKKHVLLTHHQVQPFAPHGPQSVPSLSLTPGHSASISAPGFCPFARKDDPTIQ
Download sequence
Identical sequences F7FF27
ENSMODP00000007520 ENSMODP00000007520 XP_003340069.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]