SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003340300.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003340300.2.35504
Domain Number 1 Region: 328-406
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.09e-25
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 97-131
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000178
Family Intermediate filament protein, coiled coil region 0.0019
Further Details:      
 
Weak hits

Sequence:  XP_003340300.2.35504
Domain Number - Region: 146-241
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0152
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003340300.2.35504
Sequence length 439
Comment PREDICTED: keratin, type I cytoskeletal 13 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MSCRLQTSSSTYGSGFGGGSCQLGGGRGMSSCSSRFVSSGSMGGYGGGMSCGFGGGAGSG
FGGGFCGGAGGGFGGSFGGSFGGGFDLGGGDGGLLTGNEKITMQNLNDRLASYLDKVRAL
EEANADLEVKIRDWHLKQSPTSPEKDYSPYYKTIEELRAKIQEATIDNSRTILEIDNARL
AADDFRLKYENELTLRQSVEADINGLRRVLDELTLSKTDLEMQIEGLNEELAYIKKNHEE
EMKEYSNQVVGQVNVEMDATPGIDLTRTLAEMREQYEALAEKNRRDAENWFQQKSEELNK
EVTTNTEMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLEASVAETECRYAMQLQQIQG
LISSIEAQLSDIRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLDGQDSKMTGFTTSGTT
SISSNSSSSANVSAGTRRP
Download sequence
Identical sequences F6XGN8
ENSMODP00000033291 ENSMODP00000033291 XP_003340300.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]