SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003341889.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003341889.1.35504
Domain Number - Region: 249-328
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0837
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003341889.1.35504
Sequence length 915
Comment PREDICTED: trafficking kinesin-binding protein 2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MTLPWNAISNSLTRERNLMNINHKDSESITDVCSNEDLPEVELVSLLEEQLPQYKLRVDS
LFLYENQDWTQSPHQNQHDSDAISPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLA
ERDRDLELAARIGQALLKRNHVLSEQNETLEEQLGQAFDQVNQLQHELSKKDELLRIVSI
ASEESETDSSCSTPLKFNESFSLSQGLLQLDMLQEKLKELEEENLALRSKACDIKTETIT
YEEKEQQLVNDCVKELRETNAQMSRMTEELSGKSDELIRYQEEISSLLSQIVDLQHKLKE
HVIEKEELRLHLQASKDAQRQLTMELHELQDRNAECLGMLHESQEEVKELRSRSSPAAHV
YGPQQCGAFSAESLAAEIEGTMRKELSLDEESSLCKQKVQQKRVFDTVKVANDARCRSAS
FPALLPIPGSNRSSVIMTAMPFQSDLQHMESSKHLNPKSSMDDTSKDSLKIELPGTPGVN
DLATALHRLWLRRHNYLSEKQFFAEEWERKMHVLAGEKEEASGYSTPTGSFASLCTNQSE
VTDLSTSTSCIRAFMPEKLQIVKPLEGSQTLHHWQQLAQPNLGTILDPRPGVITKGFTVL
PEDAIYHLSDLEEDEDGGITFQVQQPFQEEGKPSMSKPVPSIFLPPITSTSVPLTASNPG
KCLSSTNSTFTFTTCRILHPSDITQVTPSSKFPSLSCGSTSSSTPSTAMNSPALSYRLSM
GESVTSRRDSTTTCSSTMSLAKLLQERGISAKVYHSPISENPLILPAIKVPAIPSTPPNS
PSRSPCSSPLPFEPRAQISENFLASRPAETFLQEMYGLRPSKTPPDIGQLKMNLVDRLKR
LGIARVIKTPEMKENGKSQQGTEIGLRRPDSAAFLNASSNLLGGLRRNQSLPVMMGSFGA
PVCTSSPKMAILKED
Download sequence
Identical sequences F7B9T0
ENSMODP00000018999 XP_003341889.1.35504 XP_007501674.1.35504 ENSMODP00000018999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]