SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003373952.1.5133 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003373952.1.5133
Domain Number 1 Region: 704-746,789-952
Classification Level Classification E-value
Superfamily Bet v1-like 1.92e-28
Family STAR domain 0.017
Further Details:      
 
Domain Number 2 Region: 336-432
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-19
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003373952.1.5133
Sequence length 962
Comment collagen type IV alpha-3-binding protein [Trichinella spiralis]; AA=GCF_000181795.1; RF=representative genome; TAX=6334; STAX=6334; NAME=Trichinella spiralis; strain=ISS 195; AL=Scaffold; RT=Major
Sequence
MEYANISNAGNNSTSGYRLGQISGITLTYLIALAGQILAVVFIMAKRRVVRNNLLLPKNP
YSAAGTGASARFRAKIQRGILLTSSYKHFHPLLVGGSEQERAERFRRQAVDSFATVLTKL
GSWARFRWSRHSLPTVALLRRLVDEGYIGRQQQVTDDDCEQFASLYDTARYTSRPFGEQE
LDRFVLLYEKMFAGVESWHEKQPLEEDVMRPTGMYHITSLGTQSLNLAKRTIKRALSSHQ
QSDNVVVTTSQQQQHQQQSTGTAEPLVEHQHPPARRAQPQQQENWICGNCASSPTQHKLC
ADGFFQTTSSASRNDDNSNCAETVSWSSEGEPVESACPILTGVLNKWTNYIHGWQPRYFV
LQAGTLAYYKSEQEIEFGCRGAITVSKAIIQMHDYDDCRVDISVNDCVWYLRADRLQDRQ
RWLDAIEAYRADSGYGSQGDLCRHGSLVSLTSNKSLASSSSFKVCQGLNEKISELETYRE
IVLRQIDTLQSYFDSCAEETTSTWNIPRAPREPGEDFDDIDADHTMVHPSPHLITMGTAG
MLNAHANGTTVHHREEPTIPNAKRAADFRSEALTFKATTAGILPLLQHCTDLVQQSEDAW
KRRLEQETDRRKRADDNCRQLALELQKLHVDRSSLAFGGPDYEEGPHSALKEDEWHDALD
AALEKQDLEDRRVERLLARNVGPGKLQPFDKILLSTDHSLFNEIEQTTMEQVKYAQQGVS
DGEWQLFSEDGEMKMYRREVEIGGLVCDPLKAVHHVKVIFKTTNVTIRYIYICFFIVQFT
HNFFFRQGVSALEYLHYFYEPDYKMDWDTTLEELKVIERMSEDTMILQQIHKRVWPAAQR
ESLFWSHIRRVPKPTDSNALDMIVVCNHDTQHAAAPPNSRTVRVGLTIAMVCQTIVENAS
VDRNKLTRDDVSCKITYVAQVNPRGWAPSSVLRAVYKREYPKFLKRFTQYVLQKVENSPI
QL
Download sequence
Identical sequences E5SMW8
XP_003373952.1.5133 EFV53892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]