SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003410315.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003410315.1.64505
Domain Number 1 Region: 523-553,657-733
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000122
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003410315.1.64505
Sequence length 788
Comment PREDICTED: solute carrier family 26 member 9 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MNQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGKKLRDAFRCSSAKIKTVVFGLFPVLS
WLPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFRVFNNATNESYVDTAAMEAARLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFVRGFMTAAGLQILISVLKYVFGLTVPSYAGPGAIVFT
FIDICKNLPNTNMASLIFALISGVFLVLVKELNARYMHKIHFPIPTEMIVVVVATAISGS
YKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLSPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKNKLDCCVWVVSFLASFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGCALAQVMDTDIYVNPKTYNRVRETAGVKIVTYCSPLYF
ANSEIFRQKVIAKTGVDPQKVLLAKQKYLKKQEMGRKMPTQHKKSLFMKTKTVSLQELQQ
DFENASPTDPNNNQKPTNGASVSYITFSPDTSSGAHCELPASAESPSDTLASVPPFVTFH
TLILDMSGVSFVDLMGIKALAKLGSTFGKIGVKVFLVNIHAQVYNDISHGGVFEDGGLER
SHIFPSIHDAVLFAQAGTRDVAPGHSFQGAPVDPELSLYDLEEDSPSYWNLEQEMFGSMF
HTETLTAL
Download sequence
Identical sequences G3STX1
XP_003410315.1.64505 ENSLAFP00000003551 ENSLAFP00000003551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]