SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003453881.2.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003453881.2.78416
Domain Number 1 Region: 14-193
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.23e-45
Family G proteins 0.0000204
Further Details:      
 
Domain Number 2 Region: 193-232
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000017
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003453881.2.78416
Sequence length 292
Comment PREDICTED: ras-related protein Rab-40C [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MRGMMGTQSSPVKSYDYLLKFLLVGDSDVGKGEILDSLQDGSVESPYAYSSGIDYKTTTI
LLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNGWSFDGIDRWIREIDEHA
PGVPRILVGNRLHLAFKRQVPTEQARAYAEKNSMTFFEVSPLCNFNVIESFTELSRIVLM
RHGMEKFWRPNRVFSLQDLCCRSIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMM
HGRSYSVANSAASGGSSGGSKANSLKRSKSFRPPQSPPKSSSLSPKGNCKIS
Download sequence
Identical sequences I3KRI4
ENSONIP00000023729 ENSONIP00000023729 XP_003453881.2.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]