SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003455981.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003455981.1.78416
Domain Number - Region: 102-195
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0523
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003455981.1.78416
Sequence length 254
Comment PREDICTED: post-GPI attachment to proteins factor 2 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MLQSSDILGHERPLVIRVSFATCVLATVCLPLLGLITCVFISSVFHFEDATGTHCQVPNY
LPSISASISLSPECHIWRFCIGLHSAPRLLVAFTYFKFYKARFATRFPESSLSCLNLGFS
ISENLGLLLLTYVSSTETYFVHKEGFVLFIVSSLIYMLITCRLWKSIKKYSLNPEDAKSH
HWKVRFLLLNVSFCAFAGFFYWKHNMYCESGSYTFFALFEYLVVFSNMAFHLTAVWDFKS
REVMLISSSEDKDF
Download sequence
Identical sequences I3KJK5
ENSONIP00000021300 ENSONIP00000021300 XP_003455981.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]