SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003463657.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003463657.1.53824
Domain Number 1 Region: 621-1037
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1e-91
Family alpha-mannosidase, C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 249-516
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.45e-83
Family alpha-mannosidase 0.01
Further Details:      
 
Domain Number 3 Region: 517-617
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 9.48e-26
Family alpha-mannosidase, domain 2 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003463657.1.53824
Sequence length 1042
Comment PREDICTED: alpha-mannosidase 2C1 isoform X1 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MAAAVPALKHWRTALERVEKFVSPLYFTDCNLRGRLFGQRHPVAALSSFLTPERLRYQDA
VQQDFRPAQVGDRFGPTWWTCWFRVELIIPEAWIGQEIHLCWESDGEGLVWRDGEPVQGL
TTEGEKNSYILTNRLGEGDPRSLTLYVEVACSGLLGAGKGTMIAPPDPEKMFQLKRAELA
VFHRDIHLLLVDLELLLGIAKGLGKDNQRSFQALYTANQMVNVCDPARPETFPVAQALAS
HFFGQRGGDSQHTLHAMGHCHIDTAWLWPFKETVRKCARSWVTAVKLMEQNADFIFVCSQ
AQQLEWVKSHYPSLYAQLQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQRFFLQ
EFGKLCSEFWLPDTFGYSAQLPQIMRGCGITRFLTQKLSWNLVNSFPHHTFLWEGLDGSP
VLVHFPPGDSYGMQGNVEEVLKTVTNNQDKGRANHSAFLFGFGDGGGGPTQTMLDRLRRL
DHTDGLPRVQLSSPDQLFQALESDQGKLCTWVGELFLELHNGTYTTHAQIKKGNRECERI
LHDVELLSSLALARGTHFLYPAAQLQHLWRLLLLNQFHDVVTGSCIQLVAEDAMKHYEDI
RSHGNTLLSAAAGALCAGEPGPKGLLVVNTLPWKRTEVLALPNPGGAQTLALVTVPSIGY
APAPPAPTSPQPLLPQQPVSVMQETDGSVTLDNGIIRVRLDPTGHLTSLILVASGREAVA
EGALGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLAQAGTLAVGSEGGLRGSAWFLLQIS
PSSRLSQEVVLDIGCPYVRFHTEVYWHEAHKFLKVEFPARVRSPQATYEIQFGHLQRPTH
YNTSWDWARFEVWTHRWMDLSEHGFGLALLNDCKYGASVRGNILSLSLLRAPKAPDATAD
MGCHKFTYALMPHEGSFQDAGVIPAAYSLNFPLLVLPAPGPAPTTAWSAFSLSSPAVVLE
TIKQAETITQKRTLVLRLYEAHGSHVNCWVHTSLPVQEAVLCDLLERRDPAGHLPFQDSR
LKVTFSPFQVRSLLLVLQPPST
Download sequence
Identical sequences ENSCPOP00000009705 XP_003463657.1.53824 ENSCPOP00000009705 10141.ENSCPOP00000009705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]