SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003463658.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003463658.1.53824
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.49e-30
Family N-terminal domain of MutM-like DNA repair proteins 0.000000738
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.91e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000298
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.71e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003463658.1.53824
Sequence length 392
Comment PREDICTED: endonuclease 8-like 1 isoform X2 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MPEGPELHLASRFVNQACRGLVFCGAVEKSPVSRNPEVPFESSAYCISSMARGKELRLTL
SPLPGALPVREPLALVFRFGMTGSFQLAPAEALPPHAHLRFYTASAAPRLALCFVDIRRF
GRWDLGGEWQPDRGPCVLLEYEQFRENVLRNLADKAFNRPICEALLNQRFFNGIGNYLRA
EILFRLRIPPFEKARTVLEALQHQRLNPELTLSQKIRIKLQNPDLLELCHLVPKEVVQLG
GKGYGPEQGEEDFAAFRAWLQCYNVPGMSSLRDHNGRTIWFQGDPGPLAPKGSKFRKKKS
QETLPGPMDGMECPPPLIKGPSKTPGAQRDLPEMTTAPQPDRPGLQHDPEAPIVLEKGRR
RRRRQQATTGRRRARKRKADSPSEESGVTTAS
Download sequence
Identical sequences XP_003463658.1.53824 ENSCPOP00000009702 10141.ENSCPOP00000009702 ENSCPOP00000009702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]