SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003465639.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003465639.1.53824
Domain Number 1 Region: 92-178
Classification Level Classification E-value
Superfamily PUA domain-like 9.32e-19
Family PUA domain 0.0037
Further Details:      
 
Weak hits

Sequence:  XP_003465639.1.53824
Domain Number - Region: 51-88
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0981
Family Hypothetical protein APE0525, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003465639.1.53824
Sequence length 181
Comment PREDICTED: malignant T-cell-amplified sequence 1 isoform X4 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPG
AKLYPAAADTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
Download sequence
Identical sequences A0A286XW18
ENSCPOP00000004955 10141.ENSCPOP00000004955 XP_003465639.1.53824 ENSCPOP00000004955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]