SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003469504.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003469504.1.53824
Domain Number 1 Region: 18-279
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.83e-82
Family Carbonic anhydrase 0.0000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003469504.1.53824
Sequence length 306
Comment PREDICTED: carbonic anhydrase 4 isoform X2 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MRLPLAVLALALAASGADTESHWCYQIQVQNSQHNCLGPAQWGGECQKSQQSPIDIVTNK
ARLDYNLGDFSFSGYDKKHSRLVQNNGHSVMVSLEPDVTINGGGLATLYQATQLHLHWSE
DLNNGSEHALDGERFAMEMHIVHQKGIEGGAQNAKDQIAVLAFLVEEGSEHNDGFRVLVE
ALDKIPKPGMNVTMEASSLTDLLPQEDKLKHYFRYQGSLTTPTCDETVVWTVFKERIQLH
KDQILAFSQKLYYDEEQKLKMTDNVRPLQQLGDRLVYTSQAPAQLLPVSLPALLLPTLTY
LLANVL
Download sequence
Identical sequences H0WAL8
XP_003469504.1.53824 ENSCPOP00000020030 ENSCPOP00000020030 10141.ENSCPOP00000020030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]