SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003469728.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003469728.1.53824
Domain Number 1 Region: 224-287
Classification Level Classification E-value
Superfamily RILP dimerisation region 3.14e-18
Family RILP dimerisation region 0.0000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003469728.1.53824
Sequence length 370
Comment PREDICTED: rab-interacting lysosomal protein isoform X2 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MEPRRVTPGKPCRGPRVATGSRTAAELVYHLAGALGTELQELARRFGPEAAAGLVPLVVR
ALELLEQAAVGPAPDSLQVSAQQAEVELRRLREENEHLRREARAGPQEERALLLRLKEVT
DKQRDELRAHSRDLRQRSQETEALQEQLQRLLLVNAELRHKLAAVQAQLRAAQDREREHE
LPREGARERAEGEKQQPNPASPEDLVDALGQPGRPVEAGQCGFSREELEQILQERNELKA
KVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVKKQRKKIKAKMLGTPEEAESSDDEDG
SWPLLSKNKEDDSPPPESRVQSFFGLWCRSEAEAPRAETGSTSPSERGGEEEAPQQPHVE
PVGTPQAPNS
Download sequence
Identical sequences 10141.ENSCPOP00000009313 XP_003469728.1.53824 ENSCPOP00000009313 ENSCPOP00000009313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]