SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003470219.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003470219.1.53824
Domain Number 1 Region: 24-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000149
Family Growth factor receptor domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003470219.1.53824
Sequence length 184
Comment PREDICTED: endothelial cell-specific molecule 1 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MRSLLLLTTLLVPAHLTVAWSTKYAVDCPEHCDNSECRSSQRCKRTVLDDCGCCQVCAAG
LGETCYRTVSGMDGMKCGPGLRCQFYSEEDDFGDEFGICKDCPYGTFGIECKETCNCQSG
ICDRVTGKCLIFPFFQYSAATSSTRRSISHTDHDMASGDGNSMTEDIMKKNAAQSPVMKW
LNPR
Download sequence
Identical sequences A0A286XTF6
10141.ENSCPOP00000007253 ENSCPOP00000007253 ENSCPOP00000007253 XP_003470219.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]