SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003478745.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003478745.1.53824
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-38
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 3.01e-36
Family Link domain 0.00000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003478745.1.53824
Sequence length 277
Comment PREDICTED: tumor necrosis factor-inducible gene 6 protein [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MIILTYLFLLLWEEAQGWGFKDGIFHNSIWLEQAAGVYHREARSGKYKLTYAEAKAVCEF
EGGRLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDF
DLEDDPGCLADYVEVYDSYDDVHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QIKYIAVDPVSKSSQGKNTTTRSTGSKNFLGGRFSNL
Download sequence
Identical sequences H0VBA6
XP_003478745.1.53824 ENSCPOP00000007176 ENSCPOP00000007176 10141.ENSCPOP00000007176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]