SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003557170.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003557170.1.954
Domain Number - Region: 449-501
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0162
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003557170.1.954
Sequence length 509
Comment PREDICTED: uncharacterized protein LOC100842268 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MEMEGRGLSDLFRNTSEEIFLKAVMENSIGVAAAPSMEMMGFRNMSQSFREDSEELFNSW
LMNGEIPGFGHLNNRPRQPSRLSSEVAGIQQHGLQQQDISQQNFLTENIIPENSVVPPEY
TTNHNQQPLRNAAEKGMQASDILLAKAWFHCTQPMTRSRSSELRRRYAAMQSNLAPIVTG
THKATDQLRLDFTNVNSANSTPRGNTPIQTPTFISPSCSSTSPLDSPHMVAQDTVTSVVS
MLKDTLERKKLGSPANRDASHGSSFGFYDNQQFQHNILGGTNIFPLVTTAHAQDSLMLPE
VERPMEPNTGNFVAPTNQVWISAVSREPSQSGSSTAMTAQSAGFEVCDELPPMGQALSVC
ESTRRNAANGTSDCRSTGKDYRERVLKDNLKDDRKKVSLTRMGSISSEQAVDKGDPTKKR
RVERTRKMAEAKERSSTPVIPSDMQAVLKRCDNLEKEVRSLKLNLSFMNRKDSEQTKQIE
DLQKQNEDLAEEKERLLEEIERIASDSTT
Download sequence
Identical sequences I1H1G4
XP_003557170.1.954 XP_010228079.1.954 XP_014752363.1.954 XP_014752364.1.954 EG:BRADI1G50560.1 15368.BRADI1G50560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]