SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003557337.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003557337.1.954
Domain Number 1 Region: 25-144
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-46
Family Dcp1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003557337.1.954
Sequence length 384
Comment PREDICTED: mRNA-decapping enzyme-like protein [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MAHGGGGRAKVTPNLAMDEEGTRMLNLTVLQRLDPAVEDILITAAHVTLYDFDTVLNQWS
RKDVEGSLFVIKRNAQPRFQFIVMNRRNTDNLVENLLGDFEYQLQVPYIMYRNAAQEVIG
IWFYNSQECEEVANLFSRILNAFSKVPLKPKIPSIKSEYEELEAAPALVEGPLEPPALDI
IAPTNHAREDPLSAFFNAAANVGGASGAVVMGHAPNESFGAAPLSSHAQTSITASQPPAL
HHLHPLQASSVSGIPHDVHDGTGVISRSTNLVNPSLFSPLMSSQAMACNNSAVPTVPHQH
HWNTQQPQSAPLLQPFPLPTASPSPPYGTPLLQPFPPPNPSPSLASAPDYSSLLSRDKIR
DALLRIVANEDFIDLVYREIVKGQ
Download sequence
Identical sequences I1H2E6
EG:BRADI1G53330.3 XP_003557337.1.954 15368.BRADI1G53330.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]