SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003559105.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003559105.1.954
Domain Number 1 Region: 100-246
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.38e-52
Family C-terminal domain of ribosomal protein L2 0.00000754
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.06e-18
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003559105.1.954
Sequence length 261
Comment PREDICTED: 60S ribosomal protein L8-like [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MGRVIRAQRKGAAGSVFKSHTHHRKGPARFRALDYGERHGYLKGVVTEIVHDPGRGAPLA
RVDFREPVRYKHRKELFVAAEGMYTGQSLYCGRRAALSVGNVLPLAALPEGSVVCNVEER
VGDRGALARASGDYAIVVSHNSDAGTTRIKLPSGAKKVVQSGCRAMVGQVAGGGRTEKPL
LKAGNAYHKYRVKRNCWPRVRGVAMNPVDHPHGGGNHQHIGHASTVRRDAPPGAKTGQVA
ARRTGRRRGQDAVNAAKASLN
Download sequence
Identical sequences I1GKL2
EG:BRADI1G00867.1 XP_003559105.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]