SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003560142.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003560142.1.954
Domain Number 1 Region: 97-165
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000176
Family Ankyrin repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003560142.1.954
Sequence length 174
Comment PREDICTED: protein LHCP TRANSLOCATION DEFECT [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MASIPCTIQLATSTSSRRTSPRVPPQGTALLGRGAARRTQGWLRLGEAAPARESGRVRFF
KFGNKDAEGAGIYGSQARDDFDRDDVEQYFNYMGMLAVEGTYDKMEALLSQGTHPVDILL
LLAASEGDVPKIEELLRAGAKCDVKDPDERTALDRATSEEVRDLIAGFAPANKA
Download sequence
Identical sequences I1GTX1
EG:BRADI1G26070.1 15368.BRADI1G26070.1 XP_003560142.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]