SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003563383.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003563383.1.954
Domain Number 1 Region: 265-633
Classification Level Classification E-value
Superfamily RNI-like 5.49e-67
Family Rna1p (RanGAP1), N-terminal domain 0.041
Further Details:      
 
Domain Number 2 Region: 699-1025
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-64
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 3 Region: 25-317
Classification Level Classification E-value
Superfamily L domain-like 3.4e-62
Family Polygalacturonase inhibiting protein PGIP 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003563383.1.954
Sequence length 1039
Comment PREDICTED: putative receptor-like protein kinase At3g47110 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MARSLGALLLLSLIMRLAAATNAPNTERDALRAFRAGISDPTGALRSWNSTAHFCRWAGV
TCTGGHVTSLNVSYVGLTGTISPAVGNLTYLDTLDLNQNALSGSIPASLGRLRRLSYLGL
CDNVGLSGEIPDSLRNCTGLAAVYLNNNTLSGAIPEWLGTMPNLTYLRLSYNQLSGKIPL
SLGNLTKLQLLMLDENLLVGTLPDGLSRLALQQLSVYQNQLFGDIPSGFFSMSSLERISL
THNEFTGSLPPFAGTGMTKLEMLLLGGNKLTGTIPASLSKASGMKYLSLTNNSFTGQVPP
EIGTLCLWKLEMSNNQLTASDSGGWEFLDYLANCEDLEGLYLDGNNFGGTMPSSIGKLSK
NLKELNLGSNSISGSIPPGIGSLITLQTLGLESNLLTGSIPEGIGKLKNLMELRLQENKL
TGSVPSSIGSLTKLLILVLSNNALSGSIPSTLGNLQELTLLNLSGNALTGDVPRQLFNMP
SLSLAMDLSDNQLDGPLPTDAIRLRNLALLKLSSNRFTGEIPKQLGDCQSLEFLDLDGNF
FNGSIPMSLSKLKGLRRMNLASNKLSGSIPPELAQISGLQELYLSRNNLTGAVPEELANL
SSLVELDVSHNHLAGHLPLRGIFANMTGLKISDNSDLCGGVPQLQLQRCPVARDPRRVNW
LLHVVLPILSVALLSAILLTIFLFYKRTRHAKATSPNVLDGRYYQRISYAELAKATNGFA
EANLIGAGKFGSVYLGNLAMEVKGSPENVAVAVKVFDLRQVGATKTFLAECEALRSIRHR
NLISIVTCCSSIDARGDDFRALVFELMPNYSLDRWLHRPTTTPAKAVGSSLTVIQRLTIA
ADIADALHYLHSSCVPPIIHCDLKPSNILLDEDMTACIGDFGLAKLLLDPGIQDASGSES
TIGVRGTIGYVAPEYGTTGKVTTQGDAYSFGITLLEILSGRSPTDAAFRDGGLTLQDFVG
AAFPDRTEEVLDATLLINKEFDGDSGSSMRSSVHGYLVSAIRVGLSCTRTVPYERPGMKD
AAAELRVIRDACVRACGEP
Download sequence
Identical sequences I1GVZ5
15368.BRADI1G32160.1 EG:BRADI1G32160.1 XP_003563383.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]