SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003568995.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003568995.1.954
Domain Number - Region: 71-174
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00942
Family Myosin rod fragments 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003568995.1.954
Sequence length 355
Comment PREDICTED: FKBP12-interacting protein of 37 kDa [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MADRPPSPRLADEEDREFNASPSRNAAPVRSGEKRPFGDLDDDEEDVFASKKGKTKVEES
APGAATGMILSLRENLQNCKDNLASSQVELENAKSEIQKWHSAFQNTPAAPAGTNPEPVA
VLTYLNNLKSSEESLKEQLEKAKKREAAFIVTFAKREQEIAELKSAVRDLKTQLRPPSMQ
TRRLLLDPAIHEEFTRLKNLAEEKEKKIKELQDNVAAVNFTPSSKHGKMLMAKCRTLQEE
NEEIGAMASEGKIHELGMKIAVLKTQNKELRNQFDGLYKHMDGLTNDVERSNEMVLILQE
VLEAKNVELARLKEMVSQKDATEDKEAAEAIDETATDMNASPEPQPIKVESPNKG
Download sequence
Identical sequences I1HC86
EG:BRADI2G03820.1 15368.BRADI2G03820.1 XP_003568995.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]