SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003569736.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003569736.1.954
Domain Number 1 Region: 22-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.1e-30
Family Heat-shock transcription factor 0.00097
Further Details:      
 
Weak hits

Sequence:  XP_003569736.1.954
Domain Number - Region: 114-176
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003569736.1.954
Sequence length 247
Comment PREDICTED: heat stress transcription factor C-1b-like [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MGSECKGHHQVQDDEAGGPGAIAPFVAKTFHMVSDPATDGVVRWGGASNTFLVLDPAAFS
DLLLPSYFKHRNFASFVRQLNTYGFRKVDPDSWEFAHESFLRGQAKLLPLIVRKKKKAGA
RGELCEEEEEVRGTIRAVQRLRDERKGMEEELQAMDRRLRAAENRPGQMMAFLGKLADDP
GVVLRAMVAKKEELSAAAGGGKDSSSPQKRRRIIGAEAGRGGAVSAADAAESRAVPFPFS
ALGQVFY
Download sequence
Identical sequences I1HR89
XP_003569736.1.954 15368.BRADI2G48990.1 EG:BRADI2G48990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]