SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003577267.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003577267.1.954
Domain Number 1 Region: 12-319
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-65
Family WD40-repeat 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003577267.1.954
Sequence length 322
Comment PREDICTED: WD repeat-containing protein VIP3 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MKLAGLKSVDGAHEESVWAAAWAPAAEHRPTALLLTGALDETVRAWRADDLAAASPPARG
HALGVVSLAAHPAGVIAAAVSLDSYIRVFDVDSGASVATLDAPPSEVWGVQFHPKGVALA
AAGGGSGSVKLWDTEKWQPIASLPVPRPEGARPDKTGSGKFVLSVAWSPDGKLLACGSMD
GTIAVYDAVRMKFLHHLEGHHMPVRSMVFSPVDPHVLFTACDDAHIHIYDAKEKGLIGAM
SGHASWVLSIDVSPDGMAVATGSSDRTVRLWDINARASVQTMSNHSDQVWAVAFRPPGGE
GVRAGRLASASDDKSISLYDYS
Download sequence
Identical sequences I1IJL2
15368.BRADI4G10930.1 XP_003577267.1.954 EG:BRADI4G10930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]