SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003578408.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003578408.1.954
Domain Number 1 Region: 6-241,290-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-65
Family BAR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 501-640
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00024
Further Details:      
 
Domain Number 3 Region: 204-326,365-426
Classification Level Classification E-value
Superfamily PH domain-like 4.84e-24
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 
Domain Number 4 Region: 740-829
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.04e-23
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003578408.1.954
Sequence length 836
Comment PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MYFSRLDDSPMFRKQMQSLEEGAELLRERCLKYHKGCRKYTEGLGEAYDGDIAFASSLEA
FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDKLLQFVDMDLHDVKD
ARKRFDKASLLYDQARERYLSLKKGTRSDIATAVEDELHSARSSFEQARFNLVTALSNIE
AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLAYAQQSRERSNYEQAALVER
MQEFKRQIDRESRWSPTGMTDSPNGDGIQAIGRSSHKMIEAVMQSASKGKVQTIRQGYLS
KRSSNLRGDWKRRFFVLDNRGMLYYYRKQNSRPSSGYPNQRSSTPSEHGSGLLSRWFSSH
YHGGVHDEKSVARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESAMDQMDWIE
KITGVIANLLSSQSPERRLLLSPKGSGHHRTTSESSSFSSSTELDHSISEDCMMEKNPGS
GYFEHSSRVTQHHRTSMKPDRPIELLRKVVGNDICADCGAAEPDWASLNLGVLLCIECSG
VHRNLGVHISKVRSLTLDVRVWEPSVINLFQSLGNTFANTIWEEMLPLSSSVDHGDTPRA
DGIENTSPNLAVSKPKHSDPIALKEKFIHAKYADKDFVRKRNMDETQLAQQMWDNVSSNN
KMGVYSLIVGSHADVNLTYGQTSFNSALTLGKALLLQEQPASPSNGSSRCFDRGSLEKIS
PTDSLSPASTSERIDELDVGVEGLSLLHLACRVADVGMVELLLQYGANVNSTDSRGRTPL
HHSILKGRRVYAKLLLSRGADSRATDRDGRTALQYAIDSGTINDEEILVLLEDPSR
Download sequence
Identical sequences I1IRP5
EG:BRADI4G34880.1 XP_003578408.1.954 15368.BRADI4G34880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]