SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003581507.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003581507.1.954
Domain Number 1 Region: 69-199
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.13e-36
Family 4HBT-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003581507.1.954
Sequence length 208
Comment PREDICTED: long-chain acyl-CoA thioesterase FadM-like [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MYQQICRFVPTAHSQLPPIHAGVGRSCWPAGRFAPLRRQALASAATRRICRPLAVCAQSA
SPETGLRVDKFFEVEMKVRDYELDQYGVVNNAIYASYCQHGRHELLESIGISADAVARSG
ESLALSEMHLKYVAPLRSGDKFVVKVRLASIKGVRMIFEHYIEKLPNHELMVEAKATAVC
LNKDYRPTRLPPEFLSKLQLFSSEESSV
Download sequence
Identical sequences I1J0E3
XP_003581507.1.954 15368.BRADI5G17840.1 EG:BRADI5G17840.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]