SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003582781.3.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003582781.3.59421
Domain Number 1 Region: 28-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.55e-92
Family Calponin-homology domain, CH-domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-33
Family Spectrin repeat 0.0000925
Further Details:      
 
Domain Number 3 Region: 2175-2294
Classification Level Classification E-value
Superfamily PH domain-like 2.63e-33
Family Pleckstrin-homology domain (PH domain) 0.0000168
Further Details:      
 
Domain Number 4 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 8.76e-30
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 1850-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 5.83e-27
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.82e-26
Family Spectrin repeat 0.00000527
Further Details:      
 
Domain Number 7 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.55e-24
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 8 Region: 638-741
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-24
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 9 Region: 1532-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-24
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 10 Region: 1228-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-23
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 11 Region: 425-529
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-22
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 3.68e-20
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 13 Region: 522-643
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-18
Family Spectrin repeat 0.00081
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000102
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 15 Region: 1351-1462
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000124
Family Spectrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003582781.3.59421
Sequence length 2331
Comment PREDICTED: spectrin beta chain, erythrocytic [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDGPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWANSHLVHVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLREQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFEV
AERELGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITILNSRKFANSLAGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRDELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELERENYHDQKRIMARKDNILRLWDYLQELLQARRQRLEKTLDLQKLFQDMLHS
IDWMDGIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITTATLQFTEGPGY
QPCDPQVIQDRVSHLEQCFEELSNTAAGRKAQLEQSKQLCKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLDQIFREAEGMVARKQFGHERIEVRIKK
VSDQWNELKDLAAFCKKNLQDTENFFQFQGDADDLKAWLQDAHRLLSGEDVGHDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQAFPQGFQDSPDVTNRLQALRDLYQQVVAQADMR
QQRLQDALDLYTVFGETDACELWMGEKGKWLAQMEIPDTLEDLEVVQHRFDILDQEMKTL
MTQIDGVNLAANSLVESNHPRSAEVKKYQDRLNTRWQDFQTMVSERREAVDSALRVHNYC
VDCEETGKWIADKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQARLGTLERESQQ
LMASHPELKEDIEQRQAYVEELWQGLMQALKSQEASLGEASQLQAFLQDLDAFQAWLSTT
QKDVASKDMPESLPEAEQLLQQHAAIKDDIDRHQESYQKVRVSGEKVTHGQTDPEYLLLG
QRLDGLEKGWDALSRMWESRSQALTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLLSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNN
EKAQEASDLLKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVA
ELASHQGWLENIDAEGKQLMEEKPQFAVLVSQKLEALHQLWDELQANTQEMAQHLSAARS
SDLRSQTQADLNKWIRAMEDQLQSDDLGKDLTSVNRMLAKLKRVEDQVNVRKEELQELFA
QMPSLGEEAGDEALSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSTDYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLHRGQQLVAAAEIDCQDVEERLG
KLQGSWDTLQEAAASRLQHLREASEAQQYYLDAGEAEAWIGEQEFYVFSDENPQDEESAI
VMLKRHLRQQRAVDEYGRNIKQLAGRAQGLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERRRKLENMYHLFQLKREVDDLEQWITEKDTVASSSEMGQDFDHVTVLRDKFRDFARETG
AIGQERVDNVNAIIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLQ
RYFYTSSEILGLIGEKHRELPEDVGLDASTAESFHRTHTAFERELHLLGEQVQQFQDVAA
RLQTAYAGEKADIIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWME
SIVRQIETQEKPRDVSSVELLMKYHQGIQAEIETRSKNFSTCLELGESLLQRQHQASEEI
REKREQVVSRREEMQEKWEARWERLRMLLEVCQFFRDASVAEAWLIAQEPYLASRDYGHT
VDSVEKLIKRHEAFEKSAASWEGRFAALEKPTTLELKERQTPERTEEEPGLQEEEGETAG
EAPRGPHQATTERTSPGEEERPWPQDLQPPPPPGPHEDGQEEKSSTDERPATEPLFKVLD
TPLSEGDEPTTLPAQRDRGHSVQMEGFLGRKHDLEGPNKKASNRSWNNLYCVLRNSELAF
YKDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEML
SWLQGVSTAINESQSIRVKAQSLPLPPITGPEASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_003582781.3.59421 XP_003586637.2.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]