SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003601838.2.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003601838.2.50012
Domain Number 1 Region: 39-127
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000049
Family B3 DNA binding domain 0.0078
Further Details:      
 
Weak hits

Sequence:  XP_003601838.2.50012
Domain Number - Region: 181-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0471
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003601838.2.50012
Sequence length 237
Comment transmembrane protein, putative [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MEHQHNIQAMLSYQMLIEPLYPNPTTDMDIRMNDLRLKYRTYMVEMDVDYGAIMLPMMFS
NDFGDQIQQCAALVDPNNNQFEVLVERNNQGIYLTWGWHAMRDFYKLHLGAWITIVWMGN
GRFDIRVKNRFGRRVRYPTFTPPMEFKVEPNAVPLTYEKKLGCEDVASGCLVWFIAFACY
LWDCTLQFSMTPRPNFKIGGGWDRMVKARKIKEGARVVVAAPAMGMNLTLFITWIRQ
Download sequence
Identical sequences G7J2I2
XP_003601838.2.50012 Medtr3g085990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]