SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003627668.2.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003627668.2.50012
Domain Number 1 Region: 2188-2479
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-125
Family BEACH domain 0.00000000986
Further Details:      
 
Domain Number 2 Region: 2603-2666,2705-2824,2860-2911
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.7e-24
Family WD40-repeat 0.006
Further Details:      
 
Domain Number 3 Region: 2068-2178
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-21
Family PreBEACH PH-like domain 0.0013
Further Details:      
 
Domain Number 4 Region: 450-592
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000285
Family SO2946-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003627668.2.50012
Sequence length 2925
Comment WD-40 repeat protein/beige protein [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MEEEEKPNEVKLSGDALDDKEVIDSIGGQLDESHQNKNVNDGSGIEDEQADKTESGKTVT
DGNRFDQVLLKDQEKNNVNVESIHSLGSDNVQDSVGGNEEEFQISSGMYSPESNTSPVPA
MQHDHISYSPGSGGHFGVGFGSTGYSPQTPKQKNAMPNTSAELLHLVDSAIMGKPEGMEK
LKNIASGVEILGSGEEMESVSFLIVDSLLATMGGVECFSEDGDNNPPSVMLNSRAAIVAG
ELIPWLPYVGDTDVVMSPRTRMVRGLLAILRACTRNRAMCSTAGLLSVLLRTADKIFTVD
VGLNGQIRWDGTPLCRCIQYLAGHSLSVSDLRKWFQVITRTLTTIWAPRLMLSMEKAINE
KESMGPACTFELDGESSGLLGPGESRWPFMDGYAFATWVYIESFVDALSAATVAAAIAAA
ASAKSGKASAVSAAAAASALAGEGTEHMPRLFSFLSSDNLGIEAYFHAQFLVVEIGSGKG
KRSALHFTYAFKPQCWYFIGLEHIGNHGAMGKAENEVRLYVDGSLYESRPFEFPKISKPL
SFCCIGTNPPPTMAGLQRRRRQCPLFAEMGPVYIFKEPIGQERMARLASRGGDIVPSFGN
AAGQPWLASNAQMQNKAEESALLDAEIGGFIHLLYHPSLLSGRFCPDASPSGAAGMLRRP
AEVLGPVHVATRMRPVDALWAVAYGGPLSLLPLAISNIQEDTLEPHQGNFSVSVATTSLA
APIFRIISTAIQYPKNSEELGRCRGPEVISKVLNYLLQTLSSLGIGRDDGVGDEELVAAV
VLLCQSQKINHTLKVQLFTTLLLDIKFWSLCSYGIQKKLLSSLADMVFTESEVMRDANAI
QMLLDGCRRCYWTVPEKDPGNTVPLTGGRRPVGEVNALVDELLVVIELLIVAASPSLVSD
DVRCLLRFMVDCPQPGQISRVLHLFYRLVVQPNTSRVDTFVEAFLACGGIETLLVLLQRE
AKAGEIAVQESVSKFPGLQQNETDVSCESVQTFQDDERSDVKSESILQDNDQGSESFDSG
SNLDPGSPDGNMERMTSASEIHVKNLGGITLSISADSARKNVYNVDKSDGIVVGIIRLLG
VLVVSGHLKFGSHSVPDTTSNLLGVRLQDGGRTMFDDKVSLLLFSLQKAFQAAPNRLMTN
NTYTALLAASINASSTEKWLNFDDSGHRFEHSQLLLVLLRSLPFAPRPLQSRALQDLLFL
TCSHPENKGRLANMEEWPEWILEIMISNYELGPSKPSDSTSLGDIEDLLHNFLIVMLENS
MRQKDGWKDIEATIHCAEWLSIVGGSSTGEQRIRREESLPIFKRRLLGGLMDFAARELQA
QTQVIAVAAAGVAAEGLSPDDAKAEAENAAHLSVALVENAIVILMLVEDHLRLQSKQSSS
SRVTDVSPSPLSIFYPTNSNSRSVIGQSTEVTSDRTPSSRNSGGISIDVLSSMADANGEI
STSVIEKLAAAAAAEPYESVSCAFVSYGSCAKDLALGWKYRSRLWYGVGLPSNIASFGGG
GSGWDVWKSTLEKDASGIWIELPLVRKSVAMLQSLLLDDSGLGGGLGIGRGSGTGMGGMT
ALYQLLDSDQPFLCMLRMILLSIREEDGKEENMLIRTNIEHAVSEGEKPYSALLWSVLAP
VLNMPVSDSKRQRVLVASCVLYSEVYHAVSIDRKPLRKNYLEAILPPFAAVLRKWRPLLA
GIHELATADGFNPLNVDDNVLAADTQPVEAALAMISPAWAAAFASPPSSMALAMIAAGTS
GGESHAPSSTNVQLRRDTSLIERKHARLHTFSSFQKPSEVPKQTPPLPNNKAATKAAAFA
AARDRQRFSRIGSGRGLSAVAMATSAQRRNESDMERVKRWNITEAMEVAWTECLQPVSTQ
SVYEKDFNALSYKFIAVLVASFASARNIQRSEVDRRAREDSITRHQISTGIRAWCKLIHQ
LIEMRSLFGPFADNLYSPLRVFWKLDFMESSSRMRRYMKRNYQGSDHLGCAANYEDYSGD
KNYQRTPVLSVEAISIATINKEKKKVETENMDAKVNNIAENQPRLSDAAEETVEMSLESN
ATQLQSHKGVVQNSSAFAPGSIPSEPDEKIVLELPSSMVQPLRVLQGTFQVTSRRINFIV
DNNETSTTVEGLNFDSAVGNQRKDRSWLMSSLHQVYSRRYLLRRSALELFMVDRMNFFFD
FGSSAGRRNAYRAIVHARPPHLNNIYLATQKPEQLLKRTQLMERWARWEISNFEYLMQLN
TLAGRSYNDITQYPVFPWILSDYSSESLDLSNPSSYRDLSKPVGALNPDRLKKFQERYNS
FDDPIIPKFHYGSHYSSAGTVLYYLVRVEPFTTLEIKLQGGKFDHADRMFSDISATWNGV
LEDMSDVKELVPELFYLPEVLTNENSIDFGTTQLGEKLDSVRLPAWAENPVDFVHKHRMA
LESEYVSAHLHEWIDLIFGYKQQGKEAIEADNVFFYITYERTVDIDKISDPVQQRATQDQ
IAYFGQTPSQLLTVPHMKKMPLNEVLHLQTIFRNPKVVKPYVVPSPEYCNLPAAAIQASS
DMIVVVDSNAPAAHVAQHKWQPNTPDGHGTPFLFQRGKAASGSGGGPLRRMFKGPTGTGE
EWQYPQALAFGVSGIRSQAIISITCDQEIITGGHADNSIKVISSDGAVTLETAHAHCAPV
TCVGLSSDSNYLVSGSRDTTILLWRFHKELPSNSSFISESSTGPGTPSSRNNSSSHLIEK
NRRRRIEGPIQVLQGHQSEILSCCVSSDLGIVVSCSETSDVLFHSIRTGRLFRRLDGVVA
HSVCLSSEGVIMTWNELQHTLSTFTLNGVLIAKTELSISTSISCMETSHDGRNALIGINP
LQNGRANGGNLQSSKETAIDIRSESEETHESNIINVPTPAICFLDLHTLEVFHVLKLKEG
QDITALALNKDNTNLLVSTSDKNLIIFTDPTLSLKVVDQMLKLGW
Download sequence
Identical sequences G7LDJ7
XP_003627668.2.50012 Medtr8g035750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]