SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003655376.1.77082 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003655376.1.77082
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.77e-39
Family Calponin-homology domain, CH-domain 0.000029
Further Details:      
 
Domain Number 2 Region: 162-229
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000000000000288
Family EB1 dimerisation domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003655376.1.77082
Sequence length 242
Comment hypothetical protein THITE_71399 [Thielavia terrestris NRRL 8126]; AA=GCF_000226115.1; RF=representative genome; TAX=578455; STAX=35720; NAME=Thielavia terrestris NRRL 8126; strain=NRRL 8126; AL=Complete Genome; RT=Major
Sequence
MGESRQELVQWLNSLLQLNITKVEQCGTGAAFCQVYDSIFLDVPMSRVKFNVNTEYAYIQ
NFKILQNTFTKHQIDRSIPVEALVKCKMQDNLEFLQWTKRFWDQHYPGGEYDAVGRRKGS
ALPPSRPTPRAPSGAARRPGGTTPTMGVSRAPVKPAGGAATAALQQENNTLKEMVVGLER
ERDFYFGKLRDIELLIQQLIEEDPELEKQEDGLVVQIQNILSATEEGFEIPEPEQYDDQE
TF
Download sequence
Identical sequences G2RB69
XP_003655376.1.77082 jgi|Thite1|71399|estExt_Genewise1Plus.C_30999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]