SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003663381.1.50100 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003663381.1.50100
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Pre-PUA domain 9.15e-30
Family Nip7p homolog, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 96-171
Classification Level Classification E-value
Superfamily PUA domain-like 3.48e-24
Family PUA domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003663381.1.50100
Sequence length 183
Comment hypothetical protein MYCTH_2093073 [Thermothelomyces thermophila ATCC 42464]; AA=GCF_000226095.1; RF=representative genome; TAX=573729; STAX=78579; NAME=Thermothelomyces thermophila ATCC 42464; strain=ATCC 42464; AL=Complete Genome; RT=Major
Sequence
MRPLTDQEMKTVLDKLANYMSDLKSLIAPLEDGDRYVFRLNHSRVYYVKLSIANLATCVS
RDALLSLGTCLGKMTKSGKFRLHITALPIIAAGARHKIWVKDNGAQPFLYGSNVVKAHVG
RWSEDCPEHQGCVVYNMADIPLGFGVTARSTTEARRLDPTGIVCFRQADCGEYLRDEDTL
FAG
Download sequence
Identical sequences G2QCG0
jgi|Spoth1|67032|estExt_Genewise1.C_41018 XP_003663381.1.50100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]